TNKS Antikörper (Middle Region)

Produktnummer ABIN631422

Dieser Anti-TNKS Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von TNKS in WB. Geeignet für Human und Maus.

Kurzübersicht für TNKS Antikörper (Middle Region) (ABIN631422)

Target: TNKS (Tankyrase, TRF1-Interacting Ankyrin-Related ADP-Ribose Polymerase (TNKS))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TNKS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TNKS Antikörper

Bindungsspezifität: Middle Region

Spezifität: TNKS antibody was raised against the middle region of TNKS

Aufreinigung: Affinity purified

Immunogen: TNKS antibody was raised using the middle region of TNKS corresponding to a region with amino acids LIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQST

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TNKS Blocking Peptide, (ABIN940434), is also available for use as a blocking control in assays to test for specificity of this TNKS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNKS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TNKS

Target: TNKS (Tankyrase, TRF1-Interacting Ankyrin-Related ADP-Ribose Polymerase (TNKS))

Andere Bezeichnung: TNKS

Hintergrund: TNKS may regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles. It has PARP activity and can modify TERF1, and thereby contribute to the regulation of telomere length.

Molekulargewicht: 142 kDa (MW of target protein)